General Information

  • ID:  hor004152
  • Uniprot ID:  P25308(120-160)
  • Protein name:  Corticoliberin-2
  • Gene name:  crf2
  • Organism:  Catostomus commersonii (White sucker) (Cyprinus commersonnii)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  animal
  • Expression:  hypothalamus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Catostomus (genus), Catostomidae (family), Catostomoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SEEPPISLDLTFHLLREVLEMARAEQLVQQAHSNRKMMEIF
  • Length:  41(120-160)
  • Propeptide:  MRLNFLVTTMALLVAFPPPYECRAIDSSSNQPVTDPDEERQSPAVLARMGEEYFIRLGNRNKNSPRSPPDTYPEASQYSKRALQLQLTQRVLEGKVGNVGRWDGNYALRALDSEERERRSEEPPISLDLTFHLLREVLEMARAEQLVQQAHSNRKMMEIFGK
  • Signal peptide:  MRLNFLVTTMALLVAFPPPYECRA
  • Modification:  T41 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulate the release of corticotropin from pituitary gland
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P25308-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004152_AF2.pdbhor004152_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 555225 Formula: C212H343N59O64S3
Absent amino acids: CGWY Common amino acids: EL
pI: 4.86 Basic residues: 6
Polar residues: 5 Hydrophobic residues: 15
Hydrophobicity: -28.54 Boman Index: -7936
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 97.56
Instability Index: 6178.78 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  1726976
  • Title:  Corticotropin-releasing Factor (CRF) Gene Family in the Brain of the Teleost Fish Catostomus Commersoni (White Sucker): Molecular Analysis Predicts Distinct Precursors for Two CRFs and One Urotensin I Peptide